DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca2

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_954685.2 Gene:ca2 / 387526 ZFINID:ZDB-GENE-031219-5 Length:260 Species:Danio rerio


Alignment Length:267 Identity:83/267 - (31%)
Similarity:135/267 - (50%) Gaps:14/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSGTL--HNTGQ 101
            |.||..:||..||...|..|    |.||||||:......:|..|.||.: |:..|.:|  .|.|.
Zfish     5 WGYDKHNGPDKWGESYPIAN----GSRQSPIDIKSSTTTYDEKLTPLKL-KYDPSTSLDIQNNGH 64

  Fly   102 SLVFRVD-KDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKEL 165
            |  |:|. .|.:....::|||:...::.::.:.|:|:.:.:||||.:.|..:|.|:.:..:|.: 
Zfish    65 S--FQVSFVDDQNSSTLTGGPVTGTFRLKQFHFHWGSADDKGSEHTVNGKCYPAELHLVHWNTK- 126

  Fly   166 YHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHY 230
            |.:..:|..|..|:..:.:.::|| ..||:|:.|....:.:..:|..||..:.....|||::..|
Zfish   127 YPSFKDAVDKPDGLAVVGVFLKIG-ADNPKLQKILDAMDAIKSKGKQTPFPNFDPSVLLPSSLDY 190

  Fly   231 ITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTV 295
            .||.||.|.|...||..||:..:.|.::..::.:.|.|:...:......:.||.||.|.|..|.|
Zfish   191 WTYLGSLTTPPLLESVTWIVCKQSISVSSAQMKRFRSLLFSGDGEKACCMVNNYRPPQPLKGRVV 255

  Fly   296 RTNIDFK 302
            |.:  ||
Zfish   256 RAS--FK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 78/256 (30%)
ca2NP_954685.2 alpha_CA 1..259 CDD:320708 81/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.