DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CAH15

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster


Alignment Length:293 Identity:78/293 - (26%)
Similarity:124/293 - (42%) Gaps:36/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CSTAGFIACSAIVLLCSSEVLSSWEEWWTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKL 76
            |:.||...|..         |....|.:.||...||..|.      ..||   .||||::..:.:
  Fly    64 CANAGGDNCRR---------LRGSPESYNYDWDQGPHTWD------TACN---NQSPINIDMNCV 110

  Fly    77 LFDPYLRPL---HIDKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTE 138
            ..:.:..||   |.:...:...|.|.|.:|:.|. ...::..:|.||.|..|:.|.||...:...
  Fly   111 EINYFDTPLIWSHYNSIPLGIRLENNGHTLILRA-AFPERTPSIDGGDLLGRFDFREISFRWSWA 174

  Fly   139 NVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTF 203
            :..||||.:..:..|.|:|....:.:.....|    .|||::.:|.|..:.| .||.|.::....
  Fly   175 SSLGSEHTLDHHHSPLEMQCLHTDGDGCDGCS----SSQGVLMISYMFDLSE-HNPFLDVLIQHL 234

  Fly   204 NKVLYRGFSTPIRHISVRSLL-PNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRR 267
            ..|...|....:....:..|: |..|.:.:|.||.|.|.|.....|:|..:.:.|::::|.:.|:
  Fly   235 AAVEQAGQVVEVPPFPLSYLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQ 299

  Fly   268 L--MQGSESTPKAPLGNNARPVQSLHHRTVRTN 298
            |  .:||.      :..||||||.:..|.|..|
  Fly   300 LRDRRGSR------IARNARPVQPIGDRMVYLN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 70/259 (27%)
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 71/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.