DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CAH14

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster


Alignment Length:242 Identity:58/242 - (23%)
Similarity:98/242 - (40%) Gaps:23/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RRQSPIDVVPDKLLFDPYLRPLHIDKHK---VSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYR 125
            ::.|||.:....::......|||...::   ::..|.|.|.:::.|:.........:||..|..|
  Fly    71 KQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELLGR 135

  Fly   126 YQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGE 190
            |||.|....:|:..   |||.|..::|..|:|......:|.:|..        .:.||.:..:..
  Fly   136 YQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNFE--------YLTLSYLFALSH 189

  Fly   191 TPNPELRIITSTFNKVLYRGFSTPIRHISVRSLL-PNTDHYITYEGSTTHPGCWESTVWIIVNKP 254
            ..|..|:.:|.....:...|.|..:....:.||| |....|.:|||:..:......|.|:|..|.
  Fly   190 VKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLINRKI 254

  Fly   255 IYITKQELYQLRRL--MQGSESTPKAPLGNNARPVQSLHHRTVRTNI 299
            ..:..::|.:...|  ..|:.:.      .|.|..|.|.:|.|..||
  Fly   255 SVVDSRQLSEFEALYGRNGNRNC------KNGREKQPLGNRNVYFNI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 58/242 (24%)
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 56/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.