DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and Ca12

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001074225.1 Gene:Ca12 / 363085 RGDID:1306612 Length:354 Species:Rattus norvegicus


Alignment Length:303 Identity:90/303 - (29%)
Similarity:148/303 - (48%) Gaps:25/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CSTAGFIACSAIVLL---CSSEVLSSWEEWWTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVP 73
            ||....:....::|.   .||..|:..:  |||.|.:|...|   :.::..|. |..|||||:..
  Rat     4 CSLHATVVLLLVILKEQPSSSAPLNGSK--WTYIGPAGEKNW---SKKYPSCG-GLLQSPIDLHS 62

  Fly    74 DKLLFDPYLRPLHIDKHKVSG----TLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIH 134
            |.|.:|..|.||....:.||.    .|.|.|.|:  |::.::..::.   |...::|:.|::::|
  Rat    63 DILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSV--RLNLNSDMYIQ---GLQPHQYRAEQLHLH 122

  Fly   135 YGTEN-VRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRI 198
            :|..| ..||||.:.|..|..|:.|..:|.:||.:...|..||:|:..|:::::||.. ||....
  Rat   123 WGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYSDFGSASDKSEGLAVLAVLIEIGSV-NPSYDK 186

  Fly   199 ITSTFNKVLYRGFSTPIRHISVRSLLPNT-DHYITYEGSTTHPGCWESTVWIIVNKPIYITKQEL 262
            |.|....|.|:|....|...::..|||.: ..|..||||.|.|.|:.:.:|.:...|:.|::::|
  Rat   187 IFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQL 251

  Fly   263 YQLRRLMQGSESTPKAP--LGNNARPVQSLHHRTVRTNIDFKR 303
            ..|...:..:.....:|  :.||.|.||....|.|  .|.|::
  Rat   252 LALETALYFTHMDDPSPREMVNNFRQVQKFDERLV--YISFRQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 78/261 (30%)
Ca12NP_001074225.1 alpha_CA 39..290 CDD:294017 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.