DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CAH13

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_610602.2 Gene:CAH13 / 36126 FlyBaseID:FBgn0033542 Length:527 Species:Drosophila melanogaster


Alignment Length:297 Identity:86/297 - (28%)
Similarity:122/297 - (41%) Gaps:80/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YDGISGPSFWGLINPQWNMCNKGRR-----------QSPIDVVPDKLLFDPYLRPL----HIDKH 90
            ||...||..|         ..|.|.           |||:: :.:..:....:|.|    |.|..
  Fly    85 YDMQHGPHTW---------LPKSRSSSSSVEEATFFQSPVN-IDESQIQRMAIRELLSWNHYDDL 139

  Fly    91 KVSGTLHNTGQSLVFRVDKDTKQHVN---ISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSF 152
            ..|.||.||||:|:.|    .:.|.|   |||..|...|.|.|:..|:|..|..||||.|....|
  Fly   140 PASITLENTGQTLILR----AQFHGNAPTISGADLLASYTFLELRFHWGWCNSEGSEHTINHRKF 200

  Fly   153 PGEIQIYGFNKELYHNMSEAQHKS-QGIVGLSL----MVQIG-----ETPNP-------ELRIIT 200
            |.|:|:              .||: .||.....    ::.||     ...||       .||::.
  Fly   201 PLEMQV--------------MHKTGSGIPRTCTSSYDLLMIGYVFELSAHNPFLDPLVQNLRLVQ 251

  Fly   201 STFNKVLYRGFSTPIRHI--SVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELY 263
            ....:|....|  ||.::  ..||      .:.:|.||.|||.|::.|.|.|..:.:.|:.   :
  Fly   252 KPGKRVQISPF--PISYLMYQFRS------GFYSYGGSLTHPPCYQGTEWFIFPESLAISD---F 305

  Fly   264 QLR--RLMQGSESTPKAPLGNNARPVQSLHHRTVRTN 298
            |||  ||:.|.:..  :|:..|:||||.:.:|.|..|
  Fly   306 QLRHFRLLLGPDGI--SPIARNSRPVQHMGNRVVSLN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 84/292 (29%)
CAH13NP_610602.2 alpha_CARP_receptor_like 90..339 CDD:239396 83/289 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.