DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and Ca9

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001101426.1 Gene:Ca9 / 313495 RGDID:1306426 Length:437 Species:Rattus norvegicus


Alignment Length:265 Identity:68/265 - (25%)
Similarity:122/265 - (46%) Gaps:21/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSG----TLHNT 99
            |:|.|.       |:.||.:....||.|||:|:..:...|...|:||.:..:::..    :|.|.
  Rat   120 WSYGGT-------LLWPQVSPACAGRFQSPVDIRLELTSFCRTLQPLELLGYELQSLPELSLCNN 177

  Fly   100 GQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKE 164
            |.::...:....|..:    || ...|:..::::|:||.:..||||.:.|:.||.||.:...: .
  Rat   178 GHTVQLTLPPGLKMVL----GP-GQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLS-T 236

  Fly   165 LYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLP-NTD 228
            .:..:.||..:..|:..|:..:|.....|.....:.|...::...|....|..:.|.:||| :..
  Rat   237 AFSELHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEIAEEGSKIEIPGLDVSALLPSDLS 301

  Fly   229 HYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHR 293
            .|..||||.|.|.|.:..:|.:.|:.:.::.::|:.|...:.|...   :.|..|.|..|.|:.|
  Rat   302 RYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGLRD---SRLQLNFRATQPLNGR 363

  Fly   294 TVRTN 298
            |:..:
  Rat   364 TIEAS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 65/258 (25%)
Ca9NP_001101426.1 alpha_CA 128..370 CDD:294017 64/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.