DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and Car14

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006501505.1 Gene:Car14 / 23831 MGIID:1344341 Length:460 Species:Mus musculus


Alignment Length:263 Identity:80/263 - (30%)
Similarity:135/263 - (51%) Gaps:16/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSGT----LHNT 99
            |||:|..|...|....|:   |. |..||||::..|.::|||.|..:....:...||    |||.
Mouse    22 WTYEGPHGQDHWPTSYPE---CG-GDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNN 82

  Fly   100 GQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTE-NVRGSEHFIQGYSFPGEIQIYGFNK 163
            |.::  ::......|:    |.|..:|...::::|:|.. ::.||||.|...:...|:.:..::.
Mouse    83 GHTV--QLSLPPTLHL----GGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDS 141

  Fly   164 ELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLP-NT 227
            :.|.::|||..|.||:..|.:::::|||.||....|.|..:::.|:...|.:...|||.|.| ..
Mouse   142 QSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQL 206

  Fly   228 DHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHH 292
            :.:..|.||.|.|.|::|.:|.:.|:...|:..:|.:|:..:..:|..|..||..|.|..|.|:.
Mouse   207 EQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQ 271

  Fly   293 RTV 295
            ||:
Mouse   272 RTI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 76/256 (30%)
Car14XP_006501505.1 alpha_CA_XII_XIV 29..278 CDD:239400 76/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.