DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and Car11

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006540651.1 Gene:Car11 / 12348 MGIID:1336193 Length:344 Species:Mus musculus


Alignment Length:275 Identity:102/275 - (37%)
Similarity:161/275 - (58%) Gaps:12/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EEWWTY------DGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDK--HKV 92
            |:||:|      :.:.||.||||:|..|::|..|:||||:||...::|:||:|.||.:..  .|:
Mouse    32 EDWWSYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKL 96

  Fly    93 SGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQ 157
            .|||:|||:.:.|.  ..::..||:|||||.|.::..|:.:.:|..:..||||.|....|..|:|
Mouse    97 RGTLYNTGRHVSFL--PASRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHEGFSAEVQ 159

  Fly   158 IYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPEL-RIIT-STFNKVLYRGFSTPIRHISV 220
            :..||:|||.|:|.|.....|:..|||.|.:..:.||.| |::. .|..::.|:..:..::.:|:
Mouse   160 LIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSL 224

  Fly   221 RSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNAR 285
            ..|.|.:..:|||:||.:.|.|.|:..||::::.:.||..:::.||.|.|...|.....|..|.|
Mouse   225 ELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGR 289

  Fly   286 PVQSLHHRTVRTNID 300
            |:|.|.||.:|.|.|
Mouse   290 PLQPLAHRALRGNRD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 97/257 (38%)
Car11XP_006540651.1 alpha_CARP_X_XI_like 48..304 CDD:239395 97/257 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 234 1.000 Domainoid score I2378
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3228
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45680
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0002299
OrthoInspector 1 1.000 - - mtm8832
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.