DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CA5B

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_009151.1 Gene:CA5B / 11238 HGNCID:1378 Length:317 Species:Homo sapiens


Alignment Length:259 Identity:76/259 - (29%)
Similarity:131/259 - (50%) Gaps:10/259 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 INPQW---NMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSGTLH--NTGQSLVFRVDKDTK 112
            ::|.|   ::...|.|||||::.....::||.|:||.| .:..:..||  |.|.|.:...:..|.
Human    48 LHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTI-SYDPATCLHVWNNGYSFLVEFEDSTD 111

  Fly   113 QHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQ 177
            :.| |.||||.:.|:.::.:.|:|..:..||||.:....||.|:.:..:|...:.|..:|..:..
Human   112 KSV-IKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEEN 175

  Fly   178 GIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHYITYEGSTTHPGC 242
            |:..:.:.:::|: .:.||:.:..|...:.::.............|:|....|.||.||.|.|..
Human   176 GLAVIGVFLKLGK-HHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPL 239

  Fly   243 WESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRTNI--DFKRN 304
            .||..|||..:|:.:...:|.|.|.|:..||...:..:.:|.||:|.|.:||||::.  |:..|
Human   240 SESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLN 303

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 74/253 (29%)
CA5BNP_009151.1 alpha_CA 61..296 CDD:412109 72/237 (30%)