DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca9

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_031750918.1 Gene:ca9 / 100498132 XenbaseID:XB-GENE-6033533 Length:392 Species:Xenopus tropicalis


Alignment Length:277 Identity:83/277 - (29%)
Similarity:129/277 - (46%) Gaps:37/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQWNM----CNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKV----SGT 95
            |.|..|.          ||:.    |. |..||||:||.....||..|||:.:..:.|    :.:
 Frog    45 WNYQDIH----------QWDSDYPHCG-GPEQSPINVVTSATTFDSNLRPILLSGYNVPPSRTLS 98

  Fly    96 LHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYG 160
            |.|.|.::|.    |....:.|.|| |...|:..:::.|:|:::..||||.:.|..||||:.:..
 Frog    99 LENNGHTVVL----DLPDSLLIIGG-LPQTYRATQLHFHWGSQDDPGSEHTVNGQRFPGEMHVVH 158

  Fly   161 FNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLP 225
            ::.| |.:.:||.....|:..|.:.:|.||..||..:.:......:...|.|..|....:|.|||
 Frog   159 YSAE-YSSATEASTHPGGLAVLGVFIQEGEEENPAFQNLLPYLQNITEEGESIEIPGFDIRGLLP 222

  Fly   226 -NTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAP----LGNNAR 285
             ..|.|..|:||.|.|.|:::..|.:.|:.|.::.:::..|       |.|..|.    |.||.|
 Frog   223 QRLDRYYHYDGSLTTPPCYQTVNWTLFNQTILLSPEQMDLL-------EDTIHADHDHILQNNFR 280

  Fly   286 PVQSLHHRTVRTNIDFK 302
            ..|||:.|.|.::...|
 Frog   281 APQSLNGRLVLSSFSPK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 79/266 (30%)
ca9XP_031750918.1 alpha_CA 52..294 CDD:412109 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.