DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca3

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_002939197.2 Gene:ca3 / 100496328 XenbaseID:XB-GENE-1007186 Length:262 Species:Xenopus tropicalis


Alignment Length:263 Identity:73/263 - (27%)
Similarity:131/263 - (49%) Gaps:8/263 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKH-KVSGTLHNTGQS 102
            |.|...:||..|....|    ..||.:||||:::...:..||.|||.....| ..|.|:.|.|.:
 Frog     7 WGYASHNGPDTWAEYFP----AAKGDQQSPIELLTRYIKHDPTLRPWTSTYHPSTSLTVVNDGTT 67

  Fly   103 LVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYH 167
            .....|..|.:.| |..||:...|:..::..|:|:.:..||||.|.|:.:.||:....:|.: |.
 Frog    68 CRVVFDDSTDKSV-IKDGPMNGTYRLRQLQFHWGSSDDHGSEHVIDGFRYAGEMHFIHWNSK-YD 130

  Fly   168 NMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHYIT 232
            |::||:....|:..:::.::||:. .|.|:::....:.:..:|............|.|::..|.|
 Frog   131 NITEAKKHPDGVAIIAVFLKIGKA-KPHLKLVLEALDCIKNKGKKAHFTDFDPTILFPSSRDYWT 194

  Fly   233 YEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRT 297
            |:||.|.|.|.|...|:::::||.::.:::.:.|.:....|...:..:.:|.||.|.:..|.:|.
 Frog   195 YQGSFTTPPCEECVTWLLLSEPITVSPEQMEKFRSVYSTLEGEIECHMVDNFRPPQPVKGREIRA 259

  Fly   298 NID 300
            :.|
 Frog   260 SFD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 70/254 (28%)
ca3XP_002939197.2 alpha_CA 4..261 CDD:412109 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.