DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and LOC100496280

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_002940642.4 Gene:LOC100496280 / 100496280 -ID:- Length:313 Species:Xenopus tropicalis


Alignment Length:277 Identity:78/277 - (28%)
Similarity:119/277 - (42%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EWWTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSG---TLHN 98
            ||...|...|||.|    .....|| |.|||||::|...:.::..|.......:..|.   .|:|
 Frog    20 EWCYTDPACGPSTW----VTQGFCN-GSRQSPINIVDASVQYNASLGTFTFTNYGDSSKLVLLNN 79

  Fly    99 TGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNK 163
            .|.:    |:......|.:|||.|...|.....:.|:|..:..||||.:.|..||.|:.|.....
 Frog    80 PGHT----VEVQLASGVTLSGGGLPSTYSAVAFHFHWGNTSQNGSEHQLGGRQFPMEMHIVHTKN 140

  Fly   164 ELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIR-HISVRSLLPNT 227
            .:  |::.|:....||..|...:.:| |.:.:|..:.|....|...|.:..:. ..|:.|:|...
 Frog   141 GM--NLTAAKQDPNGIAVLGFFIDVG-TSSSKLPTLASLLVNVSNAGTNITLNGSFSIDSILGAV 202

  Fly   228 DH--YITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQL-RRLMQGSESTPKAPLGNNARPVQS 289
            |.  |..|.||.|.|.|.|:.||.:...||.:....:... ..:...|..:|: .:.||.|.:|.
 Frog   203 DRTSYYRYLGSLTTPTCDEAVVWTVFRNPILVPASVIQNFSSNIYLNSTGSPQ-NMVNNFRILQQ 266

  Fly   290 LHHRTVR--TNIDFKRN 304
            |:.|.|:  ||::...|
 Frog   267 LNSRVVQSSTNVNSAGN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 74/262 (28%)
LOC100496280XP_002940642.4 alpha_CA 41..272 CDD:412109 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.