DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and gria1a

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_991161.1 Gene:gria1a / 798689 ZFINID:ZDB-GENE-020125-1 Length:914 Species:Danio rerio


Alignment Length:104 Identity:20/104 - (19%)
Similarity:45/104 - (43%) Gaps:36/104 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 IHSTREFNFLILLTH-RMSSRAERLQVLRDISRTCVRFHTSNVILLTEKRDGVVLVYAYRLLNMD 180
            :.:..|.|:|:...: ...:.|..|:|.:|               |.:|::|.:::        |
Zfish   161 LDTAAEHNWLVTSVNVETMTEASFLKVFQD---------------LDKKKEGQIII--------D 202

  Fly   181 CDL----SVNLELIDIYKNGLFRHGHEARSFNRVLSLSG 215
            |:|    |:..::|::.||        .:|::.:|:..|
Zfish   203 CELERLTSILKKIIELGKN--------VKSYHYILANLG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
gria1aNP_991161.1 Periplasmic_Binding_Protein_Type_1 26..387 CDD:299141 20/104 (19%)
ANF_receptor 36..369 CDD:279440 20/104 (19%)
PBP2_iGluR_AMPA_GluR1 404..806 CDD:270447
Lig_chan 536..836 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.