DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and grid1a

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_021323097.1 Gene:grid1a / 793756 ZFINID:ZDB-GENE-120411-28 Length:1044 Species:Danio rerio


Alignment Length:484 Identity:96/484 - (19%)
Similarity:164/484 - (33%) Gaps:98/484 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RLLNMDCDLSVNLELIDIYKNGLFRHGHEARSFNRVLSLSGCPLQVSWYPLPPFVSFIGN-SSDP 238
            ||...|.|..:|..|    :.....||           :.|..|:|......|||....| ...|
Zfish   412 RLATWDSDRGLNGSL----RENRADHG-----------MQGITLKVVTLLEEPFVMVAENILGQP 461

  Fly   239 EERAQIWRLTGIDGELIKLLASIFDFRILLEEPCN-KCLSPDIKDDCSGCFDQVIISNSSILIGA 302
            :      |..|...:::..||.|..|:..:.:..: |..||......:|...::|...:.:.|.|
Zfish   462 K------RYKGFSIDVLDALAKILGFKYEMYQVADAKYGSPQTNGSWNGMIGELIGKRADVAISA 520

  Fly   303 MSGSHQHRSHFSFTSSYHQSSLVFIMHMSSQFGAVAQLAVPFTVIVWLALVVSSLLLVLVLWMRN 367
            ::.:.:..:...|:..|...|:..:|..:.:...:..|..||.:.||..:..:..::.:::::..
Zfish   521 ITITPERENVVDFSKRYLDYSVGILMTKTEERLNIFSLLAPFDLAVWACIAAAIPVVGVMVFLLR 585

  Fly   368 RLVCGRSD--LASHALQVLTTLMGNPL----------EARSLPRSSRLRILYAGWLLLVLVLRVV 420
            |:...||.  ...|....:||...:.:          ...|...|..|||....|.|..|::...
Zfish   586 RVQSVRSQNPPGPHQPASVTTSFQSAIWIVYGAFVQQGGESFMSSMALRIAMGSWWLFTLIVCSS 650

  Fly   421 YQGKLFDSFRLPYHKPLPTEISELIRSNYTLINQEYLDY-YPRELTVLTRNGSKDRFDYIQGLGK 484
            |...|.....:       :.:...||:...|..|..::| ..||..|         |:|.:..|.
Zfish   651 YTANLAAYLTV-------SRMDNAIRTFQDLSKQSEINYGTVRESAV---------FEYFRVKGT 699

  Fly   485 ---EGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHI---------FLYQMVIY------------ 525
               |...|...|..|:   |......:.:|...|.|         ||:.|.:.            
Zfish   700 NPLEQDSTFAELWRTI---NKNQGQDNSVTSPAEGIRKVKRDPYAFLWDMAVLEYAALTDDDCTL 761

  Fly   526 ---------------LRRHSLLKFAFDRKIKQLLSAGIIGYFVREF----DACQYRKPFEEDYEV 571
                           |:..|..:..|.:||..|...|.:....:::    ..|...|..|...|.
Zfish   762 VVTGNGMSSKGYGLALQHGSPYRDLFSQKILDLQEKGDLDILKQKWWPRKGRCDLDKHAEPQTEG 826

  Fly   572 TPIPLDSFCGLYYISLIWLSAAVVAFILE 600
            ..:.|.||.|::.|....|..|.:...||
Zfish   827 RALRLHSFAGVFCILAAGLLLACLVAALE 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
grid1aXP_021323097.1 Periplasmic_Binding_Protein_Type_1 25..424 CDD:324556 4/11 (36%)
PBP2_iGluR_delta_1 437..809 CDD:270448 75/396 (19%)
DNA_pol3_gamma3 <915..1044 CDD:331207
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.