DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and grin3a

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_009303361.1 Gene:grin3a / 564832 ZFINID:ZDB-GENE-130530-780 Length:1111 Species:Danio rerio


Alignment Length:421 Identity:81/421 - (19%)
Similarity:135/421 - (32%) Gaps:126/421 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 KC-------LSPDIKDDCSGCFDQVIISNSSI----------LIG-AMSG-SHQHRSHFS----- 314
            ||       |...:.:|....||..|:.:...          |:| .||| :|...:.||     
Zfish   580 KCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSAR 644

  Fly   315 -----FTSSYHQSSLVFIMHMSSQFGAVAQLAVPFTVIVWLALVVS----SLLLVLVLWM----- 365
                 |||.:..:||..::........:.....|....:||.:.||    ::.|.|..|.     
Zfish   645 SQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGM 709

  Fly   366 ----RNRLVCGRSDLASHALQVLTTLMGNPLEARSLPRSSRLRILYAGWLLLVLVLRVVY----- 421
                |||   .|....|.||.|...::.....|...|:....|.|...|.:..|.....|     
Zfish   710 TPRGRNR---DRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLA 771

  Fly   422 ------------------------QGKLFDSFRLPYHKPLPTEISELIRSNYTLINQEYLDYYPR 462
                                    ||..|.:.|       .:...:.::.::..:: ||:..|..
Zfish   772 AVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVR-------ESSAEDYVKKSFPEMH-EYMRRYNA 828

  Fly   463 ELTVLTRNGSKDRFDYIQGLGKEGKFTTTSLI---ATMEYYNMMHWSTSRLTHIKEHIFLYQMVI 524
            ..|       .|..|::    |:......:.|   |.::|     |:.:...:|.  :.|....|
Zfish   829 PTT-------PDGIDHL----KDDPQKLDAFIMDKALLDY-----WAHADKXYIS--LLLTGYGI 875

  Fly   525 YLRRHSLLKFAFDRKIKQLLSAGIIGYFVREFDACQYRKPFEEDYEVTPIPLDSFC-------GL 582
            .|:::|.|.......:.|..|.|.:...            .::.|:|.|....||.       |:
Zfish   876 GLKQNSPLTSNISELVSQYKSDGFMDML------------HDKWYKVVPCGKRSFAVTETLQMGI 928

  Fly   583 YYIS--LIWLSAAVVAFILELLSQRIV--WL 609
            .:.|  .:.|...|...:|..|.:.||  |:
Zfish   929 KHFSGLFVMLCVGVALSLLTTLGEHIVHRWV 959

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
grin3aXP_009303361.1 Periplasmic_Binding_Protein_Type_1 36..502 CDD:299141
ANF_receptor 132..452 CDD:279440
PBP2_iGluR_NMDA_Nr3 518..908 CDD:270438 67/368 (18%)
Lig_chan 682..941 CDD:278489 54/299 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.