DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and grid1b

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_009304811.1 Gene:grid1b / 557511 ZFINID:ZDB-GENE-121214-84 Length:1048 Species:Danio rerio


Alignment Length:467 Identity:85/467 - (18%)
Similarity:159/467 - (34%) Gaps:95/467 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 HG-----HEARSFNRVLSLSGCPLQVSWYPLPPFVSFIGN-SSDPEERAQIWRLTGIDGELIKLL 258
            ||     .|:|..|   .:.|..::|......|||....| ...|:      |..|...::::.|
Zfish   420 HGLNGSLKESRIEN---GMQGVTVKVVTLLEDPFVMVAENILGQPK------RYKGFSIDVLEAL 475

  Fly   259 ASIFDFRILLEEPCNKCLSPDIKD-DCSGCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQS 322
            |.|..|:..:.:..:......:.: ..:|...::|...:.:.:.|::.:.:..:...|:..|...
Zfish   476 AKILGFKYDIYQVADSKYGSQLSNGSWNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDY 540

  Fly   323 SLVFIMHMSSQFGAVAQLAVPFTVIVWLALVVSSLLLVLVLWMRNRLVCGRSDL---ASHALQVL 384
            |:..:.....:...:..|..||.:.||..:..:..::.:::::..|:...||..   |.||    
Zfish   541 SVGILHRKPEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQMLRSQNPPGAHHA---- 601

  Fly   385 TTLMGNPLEAR--------------SLPRSSRLRILYAGWLLLVLVLRVVYQGKLFDSFRLPYHK 435
             :.|.|.|.:.              |:..|..|||:...|.|..|::...|...|.....:    
Zfish   602 -SSMSNSLHSAIWIVYGAFVQQGGDSVVGSVALRIVMGSWWLFTLIVCSSYTANLAAFLTV---- 661

  Fly   436 PLPTEISELIRSNYTLINQEYLDY-YPRELTVLTRNGSKDRFDYIQGLGK---EGKFTTTSLIAT 496
               :.:...||:...|..|....| ..|:..|         :||.:..|.   |...|...|..|
Zfish   662 ---SRMDNTIRTFQDLARQMDFAYGTVRDSAV---------YDYFKAKGTNPLEQDSTYAELWRT 714

  Fly   497 MEYYNMMHWSTS------RLTHIKEHIFLYQMV---------------------------IYLRR 528
            :...|...:|.|      |......:.||:.|.                           |.::.
Zfish   715 ISKNNGQDFSVSSPSEGIRKAKKGPYAFLWDMAVVEYAALTDDDCTITVSGNSMSSKGYGIAMQH 779

  Fly   529 HSLLKFAFDRKIKQLLSAGIIGYFVREF----DACQYRKPFEEDYEVTPIPLDSFCGLYYISLIW 589
            .|..:....:||.:|...|.:....:::    ..|..........:...:.|.||.|::.|....
Zfish   780 GSPYRDLISQKILELQEKGDLDVLKQKWWPRTGRCDLNSHSNAQPDGRSLKLHSFAGVFCILAAG 844

  Fly   590 LSAAVVAFILEL 601
            |..|.:...||:
Zfish   845 LLLACLVAALEM 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
grid1bXP_009304811.1 PBP1_iGluR_delta_1 25..424 CDD:107387 2/3 (67%)
ANF_receptor 36..400 CDD:279440
Periplasmic_Binding_Protein_Type_2 437..809 CDD:304360 70/398 (18%)
Lig_chan 565..840 CDD:278489 53/295 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.