DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and grik2

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_021322472.1 Gene:grik2 / 556013 ZFINID:ZDB-GENE-080414-1 Length:908 Species:Danio rerio


Alignment Length:502 Identity:89/502 - (17%)
Similarity:168/502 - (33%) Gaps:117/502 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 LNMDCDLSVNLELIDIYKNGLFRHG-------------HEARSFNRVLSLSGCPLQVSWYPLPPF 228
            |..|.||.|    |.:.:.||.:.|             .:.::.|...|||...|.||.....|:
Zfish   383 LRTDFDLDV----ISLKEEGLEKIGTWDPASGLNMTENQKGKTANVTDSLSNRSLVVSTILEEPY 443

  Fly   229 VSF-------IGNSSDPEERAQIWRLTGIDGELIKLLASI--FDFRILLEEPCNKCLSPDIKDDC 284
            |.|       .||.          |..|...:|::.||:|  |.:.:.|.|........:.....
Zfish   444 VMFKKSDKPLYGND----------RFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSGQW 498

  Fly   285 SGCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMHMSSQFG-AVAQLAVPFTVIV 348
            :|...:::...:.:.:..::.::.......|:..:....:..:....:... .|.....|.:..:
Zfish   499 NGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDI 563

  Fly   349 WLALV-----VSSLLLVLVL-----WMRNRLVCGRSDLASHALQVLTTL---MGNPLEARS--LP 398
            |:.::     ||.:|.|:..     |.........||:..:...:|.:.   :|..::..|  :|
Zfish   564 WMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMP 628

  Fly   399 RSSRLRILYAGWLLLVLVLRVVYQGKLFDSFRLPYHKPLPTEISELIRSNYTLINQEYLDYYPRE 463
            ::...||:...|....|::...|...| .:|........|.:.::      .|..|..::|    
Zfish   629 KALSTRIVGGIWWFFTLIIISSYTANL-AAFLTVERMESPIDSAD------DLAKQTKIEY---- 682

  Fly   464 LTVLTRNGSKDRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSR-----LTHIKEHI--FLYQ 521
              .:..:||...|      .|:.|.:|        |..|..:.:||     :..|:|.|  .|..
Zfish   683 --GVVEDGSTMTF------FKKTKIST--------YDKMWEFMSSRRHSVMVKSIEEGIERVLTS 731

  Fly   522 MVIYLRRHSLLKFAFDRKIKQLLSAGII---GYFVREFDACQYRK-------------------- 563
            ...:|...:.::|...|........|:|   .|.|.......||.                    
Zfish   732 DYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKE 796

  Fly   564 --------PFEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILELL 602
                    |.||:.|.:.:.:.:..|::.:....|..:|...:.|.|
Zfish   797 KWWRGNGCPEEENKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFL 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
grik2XP_021322472.1 PBP1_iGluR_Kainate 37..414 CDD:380605 9/34 (26%)
Periplasmic_Binding_Protein_Type_2 430..800 CDD:419667 67/406 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.