DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and Ir92a

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:468 Identity:81/468 - (17%)
Similarity:149/468 - (31%) Gaps:141/468 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 GHEARSFNRVLSLSGCPLQVSWYPLPPFVSFIGNSSDPEERAQIWRLTGIDGELIKLLASIFDFR 265
            |.||........:..|.|:|..|....:.....|.|.             ||    :|..|::.|
  Fly   286 GAEANVMKTFCQVHNCHLRVEAYGADNWGGIYDNESS-------------DG----MLGDIYEQR 333

  Fly   266 ILLEEPCNKCLSPDIKDDCSGC----FDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVF 326
            :               :...||    :|           |....||          :..:||:..
  Fly   334 V---------------EMAIGCIYNWYD-----------GITETSH----------TIARSSVTI 362

  Fly   327 IMHMSSQFGAVAQLAVPFTVIVWL----ALVVSSLLLVLVLWMRNRLVCGRSDLASH-------- 379
            :....:...:.....:||....||    .||:....|..:.::..||....:.:..|        
  Fly   363 LGPAPAPLPSWRTNIMPFNNRAWLVLISTLVICGTFLYFMKYVSYRLRYSGTQVKFHHSRKLEKS 427

  Fly   380 ALQVLTTLMGNPLEARSLPRSSRLRILYAGWLLLVLVLRVVYQGKLFDSFRLP-YHKPLPT---- 439
            .|.:....:..|....|..|.:. |...|..|...:.|..:|.|:|......| |..|:.|    
  Fly   428 MLDIFALFIQQPSAPLSFDRFAP-RFFLATILCATITLENIYSGQLKSMLTFPFYSAPVDTIEKW 491

  Fly   440 -----------------------EISELIRSNYTLINQEYL---DYYPRELTVLTR--NGSKDRF 476
                                   |..:::..|:.:.:..||   .:.|.....:.|  :||....
  Fly   492 AQSGWKWSAPSIIWVHTVQSSDLETEQILARNFEVHDYSYLSNVSFMPNYGFGIERLSSGSLSVG 556

  Fly   477 DYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHIFLYQMVIYLRR--------HSLLK 533
            ||:         :|.:|...:..::.:::..:|...|:..|.:.::..::|.        |..|:
  Fly   557 DYV---------STEALENRIVLHDDLYFDYTRAVSIRGWILMPELNKHIRTCQETGLYFHWELE 612

  Fly   534 FA---FDRKIKQLLSAGIIGYFVREFDACQYRKPFEEDYEVTPIPLD--SFCGLYYISLIWLSAA 593
            |.   .|:|.:::|.....|:.|:.                .|..||  :..|..::....::.|
  Fly   613 FIDKYMDKKKQEVLMDLANGHKVKG----------------APQALDVRNIAGALFVLAFGVAFA 661

  Fly   594 VVAFILELLSQRI 606
            ..|.:.|||..|:
  Fly   662 GCALVAELLIHRM 674



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.