Sequence 1: | NP_572406.1 | Gene: | Ir7a / 31686 | FlyBaseID: | FBgn0029961 | Length: | 614 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991293.1 | Gene: | gria1b / 403044 | ZFINID: | ZDB-GENE-020125-2 | Length: | 917 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 39/197 - (19%) |
---|---|---|---|
Similarity: | 75/197 - (38%) | Gaps: | 33/197 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 416 VLRVVYQGKLFDSFRLPYHKPLPTEISE----LIRSNY-TLINQEYLDYYPRELT--VLTRNGSK 473
Fly 474 DRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDR 538
Fly 539 KIKQLLSAGIIGYFVREFDACQYRKPFEEDYEVTPIPLDSFCGLYYISLI--WLSAAVVAFILEL 601
Fly 602 LS 603 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir7a | NP_572406.1 | None | |||
gria1b | NP_991293.1 | PBP1_iGluR_AMPA_GluR1 | 26..387 | CDD:107385 | 39/197 (20%) |
ANF_receptor | 41..368 | CDD:279440 | |||
PBP2_iGluR_AMPA_GluR1 | 404..812 | CDD:270447 | 34/180 (19%) | ||
Lig_chan | 536..842 | CDD:278489 | 4/24 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1052 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |