DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and gria1b

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_991293.1 Gene:gria1b / 403044 ZFINID:ZDB-GENE-020125-2 Length:917 Species:Danio rerio


Alignment Length:197 Identity:39/197 - (19%)
Similarity:75/197 - (38%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 VLRVVYQGKLFDSFRLPYHKPLPTEISE----LIRSNY-TLINQEYLDYYPRELT--VLTRNGSK 473
            |....|...|.::|.|.....:.|.|.|    :::.|: .|:..:..:.|..||.  :....|..
Zfish   387 VSTATYSNMLNETFGLQNRTYVVTTILEAPYVMLKKNHEQLVGNDKYEGYCVELAAEIAKHVGYS 451

  Fly   474 DRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDR 538
            .|.:.: |.||.|.....::        |.:.....|.:.|..:.:..:.|.|.|..::.|:   
Zfish   452 YRLELV-GDGKYGARDAETM--------MWNGMVGELVYGKADVAVAPLTITLVREEVIDFS--- 504

  Fly   539 KIKQLLSAGIIGYFVREFDACQYRKPFEEDYEVTPIPLDSFCGLYYISLI--WLSAAVVAFILEL 601
              |..:|.||         :...:||.:....|... ||......::.::  ::..:||.|::..
Zfish   505 --KPFMSLGI---------SIMIKKPTKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSR 557

  Fly   602 LS 603
            .|
Zfish   558 FS 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
gria1bNP_991293.1 PBP1_iGluR_AMPA_GluR1 26..387 CDD:107385 39/197 (20%)
ANF_receptor 41..368 CDD:279440
PBP2_iGluR_AMPA_GluR1 404..812 CDD:270447 34/180 (19%)
Lig_chan 536..842 CDD:278489 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.