DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and Ir56b

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:436 Identity:78/436 - (17%)
Similarity:152/436 - (34%) Gaps:126/436 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SFIGNSSDPEERAQIWRLTGIDGELIKLLASIFDFRILLEE----PCNKCLSPDIKDDCSGCFDQ 290
            :||.|    |.:..:.:..|...|::|..|.::.:::.|:.    |....:..||   .||.:: 
  Fly    23 AFIFN----ETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDI---ISGKYN- 79

  Fly   291 VIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMH-----MSSQFGAVAQLAVPFTVIVWL 350
              :|...::|     ..:..|.| |.::.|...|..:.:     ::.:......:..|....:|.
  Fly    80 --LSLHGVII-----RPEETSDF-FNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWT 136

  Fly   351 ALVVSSLLLVLVL--------------WMRNRLVCGRSDLASHALQVLTTLMGNPLEARSLPRSS 401
            .|.:.:..:.|:|              :.||.|         ||:.:|.......:..:....|.
  Fly   137 CLFLGTFYVALLLRYVHWREPGNATRSYTRNVL---------HAMALLMFSANMNMSVKLKHASI 192

  Fly   402 RLRILYA-----GWLLL--------------VLV-------------LRVVYQGKLFDSFR-LPY 433
            |:.|.|.     |::|.              |.:             ||:|....|.:..| ||.
  Fly   193 RVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIHDSLLEELRWLPV 257

  Fly   434 HKPLPTEISELIRSNYTLINQEYLDYYPRELTVLTRNGSKDRFDYIQGLGKEGKFTTTSLIATME 498
            ::.|   ::...||...::.|:...::.|:..||.:     .:.::..:...|.|....:.:...
  Fly   258 YQAL---LASPSRSYAYVVTQDAWLFFNRQQKVLIQ-----PYFHLSKVCFGGLFNALPMASNAS 314

  Fly   499 YYNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAGIIGYF----VREFDAC 559
            :.:                            ||.||     |..:..||:..|:    .|..:..
  Fly   315 FAD----------------------------SLNKF-----ILNVWQAGLWNYWEELAFRYAEQA 346

  Fly   560 QYRKPFEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILELLSQR 605
            .|.|.|.:.|.|.|:.|:.|...:.:....:..:.:||.|||...|
  Fly   347 GYAKVFLDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELFIHR 392



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.