DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and Gria4

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001106655.1 Gene:Gria4 / 29629 RGDID:61863 Length:902 Species:Rattus norvegicus


Alignment Length:308 Identity:57/308 - (18%)
Similarity:100/308 - (32%) Gaps:79/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 SGCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSL-VFIMHMSSQFGAVAQLAVPFTVIV 348
            :|...:::...:.|.|..::.:........|:..:....: :.|.........|.....|....:
  Rat   483 NGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEI 547

  Fly   349 WLALVVSSLLLVLVLWMRNRLVC-------------GRSDLASHALQVLTTL---MGNPLE--AR 395
            |:.:|.:.:.:.:||::.:|...             |.||...:...:..:|   :|..::  ..
  Rat   548 WMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCD 612

  Fly   396 SLPRSSRLRILYAGWLLLVLVLRVVYQGKLFDSFRLPYHKPLPTEISELIRSNYTLINQEYLDYY 460
            ..|||...||:...|....|::...|...| .:|........|.|.:|      .|..|..:.| 
  Rat   613 ISPRSLSGRIVGGVWWFFTLIIISSYTANL-AAFLTVERMVSPIESAE------DLAKQTEIAY- 669

  Fly   461 PRELTVLTRNGSKDRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHIFLYQMVIY 525
                      |:.|.       |...:|...|.||.   |..| |:..|..         :..::
  Rat   670 ----------GTLDS-------GSTKEFFRRSKIAV---YEKM-WTYMRSA---------EPSVF 704

  Fly   526 LR---------RHSLLKFAFDRKIKQLLSAGIIGYFVREFDACQYRKP 564
            .|         |.|..||||      ||.:.:..|.       :.|||
  Rat   705 TRTTAEGVARVRKSKGKFAF------LLESTMNEYI-------EQRKP 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
Gria4NP_001106655.1 PBP1_iGluR_AMPA_GluR4 28..398 CDD:107383
ANF_receptor 39..380 CDD:279440
PBP2_iGluR_AMPA_GluR4 414..795 CDD:270445 57/308 (19%)
Lig_chan 546..825 CDD:278489 50/245 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.