DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and GRIN2C

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_016880033.1 Gene:GRIN2C / 2905 HGNCID:4587 Length:1337 Species:Homo sapiens


Alignment Length:452 Identity:81/452 - (17%)
Similarity:153/452 - (33%) Gaps:131/452 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 ELIKLLASIFDFRILLEEPCNKCLSPDIKDDCSGCFDQVIISNSSILIGAMSGSHQHRSHFSFTS 317
            :::|.||.:..|...|....|......::...:|...:|....:.:.||:::.:.:......|:.
Human   535 DILKKLARVVKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSV 599

  Fly   318 SYHQSSLVFIMHMSSQFGAVAQLAV--PFTVIVWLALVVSSLLLV-LVLWM-------------- 365
            .:.::.:..::..|:  |.|:..|.  |::..||:.:.|..|.:| :.::|              
Human   600 PFVETGISVMVARSN--GTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLT 662

  Fly   366 RNRLVCGRSDLASHALQVLTTLMGN---PLEARSLPRSSRLRILYAGWLLLVLVLRVVYQGKL-- 425
            |.:...|.:.....::.:|..|:.|   |:|.   ||.:..:|:...|....::....|...|  
Human   663 RGKKSGGPAFTIGKSVWLLWALVFNNSVPIEN---PRGTTSKIMVLVWAFFAVIFLASYTANLAA 724

  Fly   426 ------------------------------------FDSFRLPYHKPLPTEISEL--------IR 446
                                                .|.|:.|..:..|.....:        ||
Human   725 FMIQEQYIDTVSGLSDKKSLHLENTGVAWTAFKTFCSDYFQRPQDQYPPFRFGTVPNGSTERNIR 789

  Fly   447 SNY-------TLINQ--------------------EYLDYYPRELTVLTRNGSKDRFDYIQGLGK 484
            |||       ...||                    ..||.:..:..||.....||....:..:|.
Human   790 SNYRDMHTHMVKFNQRSVEDALTSLKMGSEAQPVPRKLDAFIYDAAVLNYMAGKDEGCKLVTIGS 854

  Fly   485 EGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAGII 549
            ...|.||.....|:  ...||        |..|.|          :||:|..|.:.::|.:..:.
Human   855 GKVFATTGYGIAMQ--KDSHW--------KRAIDL----------ALLQFLGDGETQKLETVWLS 899

  Fly   550 GYFVREFDACQYRKPFEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILELLSQRIVWLRR 611
            |       .||..|   .:...:.:.:|:..|::|:.|:.:..|::.|..|.|   :.|..|
Human   900 G-------ICQNEK---NEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHL---VYWKLR 948



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.