DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and GRID1

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_060021.1 Gene:GRID1 / 2894 HGNCID:4575 Length:1009 Species:Homo sapiens


Alignment Length:433 Identity:81/433 - (18%)
Similarity:164/433 - (37%) Gaps:57/433 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 LSGCPLQVSWYPLPPFVSFIGN-SSDPEERAQIWRLTGIDGELIKLLASIFDFRILLEEPCNKCL 276
            |.|..|:|......|||....| ...|:      |..|...:::..||....|:..:.:      
Human   434 LQGLTLKVVTVLEEPFVMVAENILGQPK------RYKGFSIDVLDALAKALGFKYEIYQ------ 486

  Fly   277 SPDIK-------DDCSGCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMHMSSQF 334
            :||.:       ...:|...::|...:.:.|.|::.:.:..|...|:..|...|:..::....:.
Human   487 APDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEK 551

  Fly   335 GAVAQLAVPFTVIVWLALVVSSLLLVLVLWMRNRLVCGRSDLASHALQVLTTLMGNPL------- 392
            .::..|..||...||..:..:..::.:::::.||:...|:..|:......:..:.:.:       
Human   552 ISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVYGAF 616

  Fly   393 ---EARSLPRSSRLRILYAGWLLLVLVLRVVYQGKLFDSFRLP-YHKPLPT--EISELIRSNY-T 450
               ...|...|..:||:...|.|..|::...|...|.....:. ...|:.|  ::|:.:..:| |
Human   617 VQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGT 681

  Fly   451 LINQEYLDYYPRELT--------------VLTRNGSKDR--FDYIQGL--GKEGKFTTTSLIATM 497
            :.:....:|:..:.|              .:::||..|.  ....:|:  .|:|.:.....:|.:
Human   682 VRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVV 746

  Fly   498 EYYNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAGIIGYFVREF----DA 558
            ||..:.....| :|.|...|......|.|:..|..:..|.::|.:|...|.:....:::    ..
Human   747 EYAALTDDDCS-VTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWPHMGR 810

  Fly   559 CQYRKPFEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILEL 601
            |..........:...:.|.||.|::.|..|.|..|.:...|||
Human   811 CDLTSHASAQADGKSLKLHSFAGVFCILAIGLLLACLVAALEL 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
GRID1NP_060021.1 Interaction with CBLN1. /evidence=ECO:0000250|UniProtKB:Q61627 21..436 1/1 (100%)
PBP1_iGluR_delta_1 25..423 CDD:107387
ANF_receptor 41..400 CDD:279440
PBP2_iGluR_delta_1 436..806 CDD:270448 68/382 (18%)
Lig_chan 564..841 CDD:278489 48/277 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 930..954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.