DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and GRIA1

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001244950.1 Gene:GRIA1 / 2890 HGNCID:4571 Length:916 Species:Homo sapiens


Alignment Length:168 Identity:36/168 - (21%)
Similarity:64/168 - (38%) Gaps:56/168 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 AER-LQVLRDISRTCV--RFHTSNVILLTEKRDGVVLVY------AYRLLNMDCD---LSVNL-E 188
            |:| |.||:.:..|..  .:..:.|.:||...:|..:::      ..||:.:||:   |:..| :
Human   161 ADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQ 225

  Fly   189 LIDIYKNGLFRH-------------------GHEARSFNRVLSLSGCPLQV--SWYPLPPFVSFI 232
            :|.:.|||:..|                   |.....|..|......|.::  .|          
Human   226 IIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQW---------- 280

  Fly   233 GNSSDPEERAQI-WR-------LTGIDGELIKLLASIF 262
             .:||..:..:: |:       || .||  :|::|..|
Human   281 -KNSDARDHTRVDWKRPKYTSALT-YDG--VKVMAEAF 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
GRIA1NP_001244950.1 PBP1_iGluR_AMPA_GluR1 36..399 CDD:107385 36/168 (21%)
ANF_receptor 47..382 CDD:279440 36/168 (21%)
PBP2_iGluR_AMPA_GluR1 416..797 CDD:270447
Lig_chan 548..827 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.