DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and Grin2c

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_036707.3 Gene:Grin2c / 24411 RGDID:2739 Length:1250 Species:Rattus norvegicus


Alignment Length:423 Identity:79/423 - (18%)
Similarity:154/423 - (36%) Gaps:102/423 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 ELIKLLASIFDFRILLEEPCNKCLSPDIKDDCSGCFDQVIISNSSILIGAMSGSHQHRSHFSFTS 317
            :::|.||.:..|...|....|......::...:|...:|....:.:.||:::.:.:......|:.
  Rat   473 DILKKLAKVVKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSV 537

  Fly   318 SYHQSSLVFIMHMSSQFGAVAQLAV--PFTVIVWLALVVSSLLLV-LVLWM-------------- 365
            .:.::.:..::..|:  |.|:..|.  |::..||:.:.|..|.:| :.::|              
  Rat   538 PFVETGISVMVSRSN--GTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLT 600

  Fly   366 RNRLVCGRSDLASHALQVLTTLMGN---PLEARSLPRSSRLRILYAGWLLLVLVLRVVY------ 421
            :.:...|.|.....::.:|..|:.|   |:|.   ||.:..:|:...|....::....|      
  Rat   601 KGKKPGGPSFTIGKSVWLLWALVFNNSVPIEN---PRGTTSKIMVLVWAFFAVIFLASYTANLAA 662

  Fly   422 ---QGKLFDS--------FRLPYHKPLPTEISEL--------IRSNY------------------ 449
               |.:..|:        |:.|..:..|.....:        |||||                  
  Rat   663 FMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDA 727

  Fly   450 -TLINQEYLDYYPRELTVLTRNGSKDRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHI 513
             |.:....||.:..:..||.....||....:..:|....|.||.....|:  ...||        
  Rat   728 LTSLKMGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQ--KDSHW-------- 782

  Fly   514 KEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAGIIGYFVREFDACQYRKPFEEDYEVTPIPLDS 578
            |..|.|          :||:...|.:.::|.:..:.|       .||..|   .:...:.:.:|:
  Rat   783 KRAIDL----------ALLQLLGDGETQKLETVWLSG-------ICQNEK---NEVMSSKLDIDN 827

  Fly   579 FCGLYYISLIWLSAAVVAFILELLSQRIVWLRR 611
            ..|::|:.|:.:..|::.|..|.|   :.|..|
  Rat   828 MAGVFYMLLVAMGLALLVFAWEHL---VYWKLR 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
Grin2cNP_036707.3 PBP1_iGluR_NMDA_NR2 41..397 CDD:380601
PBP2_iGluR_NMDA_Nr2 413..813 CDD:270436 67/371 (18%)
NMDAR2_C 850..>925 CDD:402274 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.