DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and W02A2.5

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_502564.2 Gene:W02A2.5 / 189098 WormBaseID:WBGene00012190 Length:487 Species:Caenorhabditis elegans


Alignment Length:361 Identity:72/361 - (19%)
Similarity:134/361 - (37%) Gaps:116/361 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 FTSSYHQSSL--VFIMHMSSQ-FGAVAQLAV-PFTVIVWLALVVSSLLLVLV----------LWM 365
            |..||..:::  ||:....:: .|:|...|. ||:|.|||.|:.|.:|.:|:          |..
 Worm   107 FEYSYPVTNVQPVFVARKKTETLGSVLWNAFKPFSVEVWLCLLASLVLNLLIMIAISGIEFKLLF 171

  Fly   366 RNRLVCGRS-DLASHALQ----------VLTTLMGN-PLEARSLPRSSRLRILYAGWLLLVLV-- 416
            |:|.   |. ::..|.:|          :..||.|| .|...:|.:|..|..:|.|.||..|:  
 Worm   172 RSRF---RPWEMLWHVVQLQLDEKSDDMLFYTLSGNIVLFVFALLQSGILIEVYKGMLLTALITS 233

  Fly   417 ----------------------LRVVYQGK-LFDSFRLPYHKPLPTEIS---------------- 442
                                  |...|.|. .||..:   |......:|                
 Worm   234 NGDNPFANADEMIKLIGEKKYHLTTNYMGNWYFDDLQ---HSDQQHFVSLRAATASNPVIPAASV 295

  Fly   443 ----ELIRSNYTLINQEYLDYYPRELTVLTRNGSKDRFDYI---QGLGKEGKFTTTSLIATMEYY 500
                :|:.|.      :|:  ||.:...|....||:|.:|:   .|:.:...|    .:.|..:.
 Worm   296 SAALDLVDSG------KYI--YPIQQDSLAMQMSKERCNYVYVSDGMPQVSSF----FVFTKNFS 348

  Fly   501 NMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAGIIGYFVREFDACQYRKPF 565
            .:..::|             |:::   ..:.::..|::...:....|.|       ..|:..:|.
 Worm   349 GIAEFNT-------------QIIM---NQAFIQRTFNKYFNEGFKLGFI-------PKCEVTEPT 390

  Fly   566 EEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILEL 601
            ..| ...|:.::|..|::.|..:.::|:::.|:.|:
 Worm   391 ASD-ATKPLDIESVIGVFTIGALGVAASLMVFVFEI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
W02A2.5NP_502564.2 Lig_chan-Glu_bd <36..86 CDD:214911
Periplasmic_Binding_Protein_Type_2 <74..>124 CDD:304360 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.