DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and gria3a

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_005165152.1 Gene:gria3a / 170452 ZFINID:ZDB-GENE-020125-5 Length:903 Species:Danio rerio


Alignment Length:677 Identity:129/677 - (19%)
Similarity:208/677 - (30%) Gaps:262/677 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 FVVFLVNSAQAFNTLGFHFT----DIHSTREFNFLILLTHRMSSRAER----------LQVLRDI 146
            |.|.|.|:.|......||..    ::.|:..|:    :||...|:..|          .:.:..:
Zfish    46 FAVQLYNTNQNITEKPFHLNYNVDNLESSNSFS----VTHAFCSQFSRGVYAIFGFYDRRSMNTL 106

  Fly   147 SRTCVRFHTSNVILLTEKRDGVVLVYAYRLLNMDCDL-SVNLELIDIYKNGLFRHGHEA-RSFNR 209
            :..|...|||.:.........|..|     |.|...| ...|.|:..||...|.:.::. |.|:.
Zfish   107 TSFCGALHTSFITPSFPTDTDVQFV-----LQMRPSLRGALLSLLAHYKWEKFVYLYDTDRGFSI 166

  Fly   210 VLSLSGCPLQVSWYPLPPFVSFIGNSSDPEERAQIWRLTGIDGELIKLLASIFDFRILLEEPCNK 274
            :.::....:..:|...   ...:||..||                       .::|.::|| .::
Zfish   167 LQAIMESAVMNNWQVT---ARSVGNIVDP-----------------------LEYRRIIEE-MDR 204

  Fly   275 CLSPDIKDDC-----SGCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMHMSSQF 334
            ........||     :...:||:|:..:     ..|.|...::..||:          |.:...|
Zfish   205 RQEKRFLIDCEVERINSILEQVVIAGKN-----SRGYHYILANLGFTN----------MSLDKVF 254

  Fly   335 GAVA-----QLAVPFTVIV------W-------------------LALVVSSLLLVLVLW---MR 366
            ...|     |:..|.:.||      |                   .||...::|::...:   .|
Zfish   255 SGGANITGFQIINPDSPIVQQFLQRWERLDEREFPESRSSPLKYTSALTHDAILVIAEAFRYLRR 319

  Fly   367 NRLVCGRSDLASHALQVLTTLMGNPLEARSLPRSSRLRILYAGWLLLVLVLRVVYQGKL----FD 427
            .|:...|...|...|       .||    ::|.|..:.|..|  |.:|.|     ||..    ||
Zfish   320 QRVDISRRGSAGDCL-------ANP----AVPWSQGIDIERA--LKMVQV-----QGMTGNIQFD 366

  Fly   428 SFRLPYHKPLPTEISELIRSNYTL-----------------------------INQEYLDYYPRE 463
            ||..              |||||:                             :..|......|.
Zfish   367 SFGR--------------RSNYTVDVYEMKPGGARKIGYWNEFEKFVYIVEQQVTNESSSVENRT 417

  Fly   464 LTVLT----------RN----GSKDRFD-YIQGLGKE-----GKFTTTSLIATMEY--------- 499
            :.|.|          ||    ...||:: |...|..|     |.....|::|..:|         
Zfish   418 IVVTTIMEAPYVMYKRNYMQLEGNDRYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETKT 482

  Fly   500 YNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAGI---------------- 548
            :|.|   ...|.:.:..|.:..:.|.|.|..::.|:     |..:|.||                
Zfish   483 WNGM---VGELVYGRADIAVAPLTITLVREEVIDFS-----KPFMSLGISIMIKKPQKSKPGVFS 539

  Fly   549 -----------------IGYFVREFDACQYRKPFE---------EDYEVTPIPLDSFCGLYYISL 587
                             ||..|..|...:: .|:|         :|.:..|.|.:.| |::  :.
Zfish   540 FLDPLAYEIWMCIVFAYIGVSVVLFLVSRF-SPYEWHLDDNEETKDPQTPPDPPNDF-GIF--NS 600

  Fly   588 IWLSAAVVAFILE-------LLSQRIV 607
            :|.|..  ||:.:       .||.|||
Zfish   601 LWFSLG--AFMQQGCDISPRSLSGRIV 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
gria3aXP_005165152.1 PBP1_iGluR_AMPA_GluR3 28..399 CDD:107382 82/435 (19%)
ANF_receptor 39..382 CDD:279440 82/418 (20%)
PBP2_iGluR_AMPA 415..797 CDD:270433 46/225 (20%)
Lig_chan 547..810 CDD:278489 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.