DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and Grik1

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_006522977.1 Gene:Grik1 / 14805 MGIID:95814 Length:949 Species:Mus musculus


Alignment Length:521 Identity:93/521 - (17%)
Similarity:187/521 - (35%) Gaps:128/521 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 TEKRDGVVLVYAYRLLNMDCDLSVNLELIDIY--KNGL-FRHGHEARSFNRVLSLSGCPLQVSWY 223
            |||..|.|..:.|::          .:.|.|:  .:|| ...|:..||.|...||:...|.|:..
Mouse   400 TEKASGEVSKHLYKV----------WKKIGIWNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTI 454

  Fly   224 PLPPFVSF-------IGNSSDPEERAQIWRLTGIDGELIKLLASI----FDFRILLEEPCNKCLS 277
            ...|:|.:       .||.          |..|...:|:|.|::|    :|.:::   |..|..:
Mouse   455 LEEPYVMYRKSDKPLYGND----------RFEGYCLDLLKELSNILGFLYDVKLV---PDGKYGA 506

  Fly   278 PDIKDDCSGCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMHMSSQFG-AVAQLA 341
            .:.|.:.:|...::|...:.:.:..::.::.......|:..:....:..:....:... .|....
Mouse   507 QNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL 571

  Fly   342 VPFTVIVWLALVVSSLLLVLVLWMRNRLV---------CG-RSDLASHALQVLTTL---MGNPLE 393
            .|.:..:|:.::::.|.:..||::..|..         |. .||:..:...:|.:.   :|..::
Mouse   572 NPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQ 636

  Fly   394 ARS--LPRSSRLRILYAGWLLLVLVLRVVYQGKLFDSFRLPYHKPLPTEISELIRSNYTLINQEY 456
            ..|  :|::...||:...|....|::...|...| .:|........|.:.::      .|..|..
Mouse   637 QGSELMPKALSTRIVGGIWWFFTLIIISSYTANL-AAFLTVERMESPIDSAD------DLAKQTK 694

  Fly   457 LDYYPRELTVLTRNGSKDRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSR-----LTHIKEH 516
            ::|      ...|:||...|      .|:.|.:|        |..|..:.:||     :.:..|.
Mouse   695 IEY------GAVRDGSTMTF------FKKSKIST--------YEKMWAFMSSRQQSALVKNSDEG 739

  Fly   517 IFLYQMVI-----YLRRHSLLKFAFDRKIKQLLSAGII---GYFVREFDACQYRK---------- 563
            |   |.|:     .|...:.:::...|........|:|   ||.|.......||.          
Mouse   740 I---QRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQ 801

  Fly   564 ------------------PFEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILELLSQRIVWLR 610
                              |.|:..|.:.:.:::..|::.:    |:|.:|..:...:.:.|...|
Mouse   802 EEGKLHMMKEKWWRGNGCPEEDSKEASALGVENIGGIFIV----LAAGLVLSVFVAIGEFIYKSR 862

  Fly   611 R 611
            :
Mouse   863 K 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
Grik1XP_006522977.1 PBP1_iGluR_Kainate 38..431 CDD:380605 10/40 (25%)
Periplasmic_Binding_Protein_Type_2 446..815 CDD:389745 68/411 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.