DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7a and si:dkey-183j2.10

DIOPT Version :9

Sequence 1:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_001923977.1 Gene:si:dkey-183j2.10 / 100151589 ZFINID:ZDB-GENE-130530-729 Length:465 Species:Danio rerio


Alignment Length:429 Identity:74/429 - (17%)
Similarity:154/429 - (35%) Gaps:104/429 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 DPEERAQIWRLTGIDGELIKLLASI--FDFRILLEEPCNKCLSPDIKD----------DCSGCFD 289
            ||...::..:|.|...:|:..||..  |.:::.|           :||          :.:|...
Zfish    39 DPYTMSKGSQLEGYCMDLLTELAKKLGFKYKVHL-----------VKDGSYGRQDENGNWNGMIG 92

  Fly   290 QVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMH---MSSQFGAVAQLAVPFTVIVWLA 351
            :|:...:.:.:..::.:.........|..|.|:.:..::.   :|.:.|....|: ||:...|..
Zfish    93 EVVRGEADLAVAPLTLTAAREKAVGMTKPYMQTGISILLRKDIVSEEAGFFDFLS-PFSGETWFG 156

  Fly   352 LVVSSLLLVLVLWMRNRL-VCGRSDLAS--------HALQVLT---TLMGNPLEARSLPRSSRLR 404
            ::::..:..:.:.:..|| .|..|...:        |:|....   :|.|    |...|::...|
Zfish   157 ILIAYFVTAVCICIVGRLSPCEWSQPETEPNHFTLLHSLWYTAGALSLQG----AGPHPKAVSGR 217

  Fly   405 ILYAGWLLLVLVLRVVYQGKLFDSFRLPYHKPLPTEISELIRSNYTLINQEYLDY---------- 459
            ::...|.|..:||...|...| .|.:.....||      :|:....|.||:.::|          
Zfish   218 VISCTWWLFAVVLLACYFSSL-SSTQGSDSAPL------MIKGFEDLANQDVIEYGTLAGSSTLA 275

  Fly   460 ---------YPRELTVLTRNGSKDRFDYIQGL------GKEGKFTTTSLIATMEYYNMMHWSTSR 509
                     |.|....:.|     |..::..:      .|||.:.......:::.....|...  
Zfish   276 FFKNSNNPSYRRIYEHMER-----RKSFVSSMDEGVQKAKEGNYAFIGESVSLDLAVARHCEL-- 333

  Fly   510 LTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIK-------QLLSAGIIGYFVREF--DACQYRKPF 565
               ::.|     .||.:|.:|::.......:|       ||..||.:.|...::  .:|     .
Zfish   334 ---VRAH-----EVIGMRGYSIVTPLGSAMLKNLSVAILQLSEAGELAYLRTKWWASSC-----L 385

  Fly   566 EEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILELLSQ 604
            .::.:.:.:...|..|::.:..|.|...|:..:.||.::
Zfish   386 PDNAKASSLRAHSMKGIFLVLAIGLGIGVLLSLFELTTK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7aNP_572406.1 None
si:dkey-183j2.10XP_001923977.1 PBP2_iGluR_non_NMDA_like 28..381 CDD:270403 66/379 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.