DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab11a

DIOPT Version :10

Sequence 1:NP_572405.2 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_112414.1 Gene:Rab11a / 81830 RGDID:619762 Length:216 Species:Rattus norvegicus


Alignment Length:171 Identity:83/171 - (48%)
Similarity:118/171 - (69%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQE 70
            ::|.|:::|||||.||||:||..||..:|...|..|:||:|..|.|:: ||..||.|:|||||||
  Rat     8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQV-DGKTIKAQIWDTAGQE 71

  Fly    71 RFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHR 135
            |:|:||.:|||.:||.||||||:.|.::|::..|:.|.:.|.:.: .|..|||.|.||.:.   |
  Rat    72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSN-IVIMLVGNKSDLRHL---R 132

  Fly   136 EVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVY 176
            .|.|:||:.||:::||.|:||||....|||.||:.:..|:|
  Rat   133 AVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIY 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_572405.2 Rab39 8..218 CDD:133311 83/169 (49%)
Rab11aNP_112414.1 Rab11_like 9..173 CDD:206660 82/168 (49%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62491 36..47 4/10 (40%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62491 67..86 12/18 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..211
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.