DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab42

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_008762416.2 Gene:Rab42 / 682865 RGDID:1593983 Length:215 Species:Rattus norvegicus


Alignment Length:215 Identity:99/215 - (46%)
Similarity:134/215 - (62%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YQFRLILIGDSTVGKSSLLKFFTDGK--FAELS-DPTVGVDFFARLIEMKDGTQIKLQLWDTAGQ 69
            ||||:.|:||:.|||:|||:.:..|.  .|||. :|||||:|::|.:.:..|.::||||||||||
  Rat     8 YQFRIALLGDAAVGKTSLLRCYVAGARGAAELDPEPTVGVEFYSRALRLPAGLRVKLQLWDTAGQ 72

  Fly    70 ERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPH---RPVFALVGCKLDLINA 131
            ||||.||:|:|||.||||||:|::|..|||||..|..|.   |..|   :.:|.|||.|.||   
  Rat    73 ERFRCITRSFYRNMVGVLLVFDVTNRESFEHIQAWHQEV---ISTHGSDKVIFLLVGHKCDL--- 131

  Fly   132 GGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSG 196
             ..|.|:|:||::.|...|:.||||||:|..||:.||..||..:...::.|:.|.|:.|.|::..
  Rat   132 -STRCVSTQEAEELAASLGMAFVETSAKSNCNVDLAFDTVTSAIEQALQQGDIKLEEDWAGVRLL 195

  Fly   197 FSRPNSLDFNLVVAEPEKSS 216
            ...||          |..||
  Rat   196 HRAPN----------PRSSS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 99/215 (46%)
Rab42XP_008762416.2 P-loop_NTPase 8..215 CDD:422963 99/215 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.