DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and rab39ba

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001092211.1 Gene:rab39ba / 562596 ZFINID:ZDB-GENE-070620-7 Length:213 Species:Danio rerio


Alignment Length:217 Identity:113/217 - (52%)
Similarity:165/217 - (76%) Gaps:4/217 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDT 66
            :|.|:.||||||:|||||||||.|::.||:|:||::||||||||||:||:|::.|.:||||:|||
Zfish     1 MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDT 65

  Fly    67 AGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINA 131
            ||||||||||::|||||||.||::||:|..||:::..|:.||:.|::||..||.|||.|.||.. 
Zfish    66 AGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEEARSHVQPHSIVFILVGHKCDLEQ- 129

  Fly   132 GGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSG 196
              .|:|:.:||:|.|..:|:.:||||||...|||:||..:|::::..::.|:...::||:|:|||
Zfish   130 --QRQVSQQEAEKLAAAYGMRYVETSARDAINVEKAFTELTRDIFELVKCGDITIQEGWEGVKSG 192

  Fly   197 FSRPNSLDFNLVVAEPEKSSCC 218
            |. ||.:..:..|.:.::...|
Zfish   193 FV-PNVVHSSEEVTKSDRRCLC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 110/209 (53%)
rab39baNP_001092211.1 Rab39 7..213 CDD:133311 110/209 (53%)
RAB 9..172 CDD:197555 97/165 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 202 1.000 Domainoid score I2940
eggNOG 1 0.900 - - E2759_KOG0091
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H62377
Inparanoid 1 1.050 237 1.000 Inparanoid score I3349
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416096at2759
OrthoFinder 1 1.000 - - FOG0003983
OrthoInspector 1 1.000 - - otm25140
orthoMCL 1 0.900 - - OOG6_105997
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3742
SonicParanoid 1 1.000 - - X2743
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.860

Return to query results.
Submit another query.