DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and rab42b

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001017683.2 Gene:rab42b / 550378 ZFINID:ZDB-GENE-050417-172 Length:218 Species:Danio rerio


Alignment Length:213 Identity:102/213 - (47%)
Similarity:144/213 - (67%) Gaps:1/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQ 69
            :::||||:|::|||||||||:||.:|:..|.|..:.||||||:...:|::.|.::|||.||||||
Zfish     5 LWQYQFRIIMLGDSTVGKSSMLKRYTEDLFLECINQTVGVDFYVHFLEVEPGVRVKLQFWDTAGQ 69

  Fly    70 ERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGH 134
            |||||:|:||||||||.|||:|:.|..|||::..|..|....:.|:..:|.|||.|.|.:. ||.
Zfish    70 ERFRSVTRSYYRNSVGGLLVFDLGNRKSFENVREWYAEVCERVHPYTVLFVLVGHKSDRVK-GGE 133

  Fly   135 REVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSR 199
            |.|...||:|.|.|.|..::|.||::|.||:|||.::|:.:|..::|||.:..:||||:||....
Zfish   134 RAVDRTEAEKLASQLGAPYIEASAKTGHNVKEAFDLLTRRIYQGLKSGEIQLREGWDGVKSSAPT 198

  Fly   200 PNSLDFNLVVAEPEKSSC 217
            ..:|.........||.||
Zfish   199 AQTLQKLQNNESAEKKSC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 102/210 (49%)
rab42bNP_001017683.2 P-loop_NTPase 8..218 CDD:304359 102/210 (49%)
RAB 10..176 CDD:197555 85/166 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.