DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and RabX1

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster


Alignment Length:215 Identity:68/215 - (31%)
Similarity:114/215 - (53%) Gaps:21/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLILIGDSTVGKSSL-LKFFTDGKFAELSD-PTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFR 73
            :::::|...|||:.| :::..:....:.|: ||:.|.||...| :.|..:||||:||||||||:|
  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNI-ILDEVKIKLQIWDTAGQERYR 70

  Fly    74 SITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVT 138
            ::...||||:...:||:|::.:.:|..|..|:.|..|:::... :..|||.|:|:   ...|.|:
  Fly    71 AVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPM-ILTLVGNKMDM---QAQRAVS 131

  Fly   139 TEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSRPNSL 203
            .|||..||...|..:.|||..:...:|:.| :.|.:...|:      |::|.......|...:||
  Fly   132 REEAFVFATSIGATYFETSTETDQGLEQVF-ISTAQGLVRL------ADEGKSPSLRSFQSTDSL 189

  Fly   204 -------DFNLVVAEPEKSS 216
                   .|:..||...:||
  Fly   190 AYTNTNTAFSHTVAALARSS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 68/215 (32%)
RabX1NP_524713.1 Ras 7..166 CDD:278499 57/164 (35%)
Rab 7..166 CDD:206640 57/164 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.