DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab7

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster


Alignment Length:206 Identity:69/206 - (33%)
Similarity:121/206 - (58%) Gaps:24/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFRSI 75
            ::|::|||:|||:||:..:.:.:|:.....|:|.||..:.:.:.|.. :.:|:|||||||||:|:
  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRV-VTMQIWDTAGQERFQSL 73

  Fly    76 TKSYYRNSVGVLLVYDISNHASFEHIPLW----MMEAQRHIEPHRPVFALVGCKLDLINAGGHRE 136
            ..::||.:...:||||::...||:::..|    :::|......|.| |.::|.|:||.|    |:
  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFP-FVVLGNKVDLDN----RQ 133

  Fly   137 VTTEEAQKFAK-QHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAE-----DGWDGIKS 195
            |:|..||::.: ::.:.:.||||:.|.|||.||:::.:...      |.:||     |..|.|..
  Fly   134 VSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNAL------ELEAEAEVINDFPDQITL 192

  Fly   196 GF--SRPNSLD 204
            |.  :||.:.|
  Fly   193 GSQNNRPGNPD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 69/206 (33%)
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 60/180 (33%)
RAB 9..174 CDD:197555 59/169 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.