DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab11

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster


Alignment Length:216 Identity:92/216 - (42%)
Similarity:131/216 - (60%) Gaps:7/216 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTA 67
            |..::|.|:::|||||.||||:||..||..:|...|..|:||:|..|.||: ||..||.|:||||
  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEV-DGKTIKAQIWDTA 68

  Fly    68 GQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAG 132
            ||||:|:||.:|||.:||.||||||:.|.::|::..|:.|.:.|.: ...|..|||.|.||.:. 
  Fly    69 GQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHAD-QNIVIMLVGNKSDLRHL- 131

  Fly   133 GHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGF 197
              |.|.|:||:.||:::||.|:||||....|||.||:.:..|:|..:...:.:.....|.|:...
  Fly   132 --RSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSN 194

  Fly   198 SRPNSLDFNLVVAEPEKSSCC 218
            ..|  :|....|....:..||
  Fly   195 VEP--IDVKPTVTADVRKQCC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 89/209 (43%)
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 83/168 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.