DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab23

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:229 Identity:69/229 - (30%)
Similarity:111/229 - (48%) Gaps:25/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWD 65
            |.|...|...:::::|:..|||||:::.:..|.|.:....|:||||..|.||: ||..:::.|||
  Fly    29 MREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEI-DGEDVRIMLWD 92

  Fly    66 TAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLIN 130
            |||||.|..|||:|||.:...:||:..::.|||:.|..|..:.:.  |.:.....:|..|:|||.
  Fly    93 TAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVEN--ECNEIPTVIVQNKIDLIE 155

  Fly   131 AGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFR--------MVTQEVYARIRSGE---- 183
               ...||.:|.:..||......:.||.:...||...||        ::||. |.::...:    
  Fly   156 ---QAVVTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQS-YDQVAGNQQNSS 216

  Fly   184 ---YKAEDGWDGIKSGFSRPNSLDFNLVVAEPEK 214
               |.:..........|::.:|   ..:|..|.|
  Fly   217 HPPYSSTPTISAFSPTFTKSSS---GTIVLRPAK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 66/222 (30%)
Rab23NP_649574.1 Ras 50..199 CDD:278499 54/154 (35%)
Rab23_like 50..197 CDD:133306 54/152 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.