DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and rab42a

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_998207.1 Gene:rab42a / 406315 ZFINID:ZDB-GENE-040426-1983 Length:213 Species:Danio rerio


Alignment Length:221 Identity:115/221 - (52%)
Similarity:158/221 - (71%) Gaps:12/221 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDT 66
            ::.:::||||:||:||||||||||||.||||.:::::||||||||:||.|:::.|.:||||||||
Zfish     1 MDTLWQYQFRIILLGDSTVGKSSLLKRFTDGIYSDVADPTVGVDFYARSIDIEPGVKIKLQLWDT 65

  Fly    67 AGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINA 131
            ||||||||||.||||||||.|||:|::|..:|:|:..|..|...||.||..|:.|:|.|.||   
Zfish    66 AGQERFRSITTSYYRNSVGGLLVFDLTNRKTFDHVREWHREVSEHILPHHMVYILIGHKSDL--- 127

  Fly   132 GGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSG 196
            ...|:||.:||::.|...|:.:|||||:..:|||.||.::|:::|..::.||....|||||:|||
Zfish   128 SRDRKVTRDEAEQLAADLGIRYVETSAKCNSNVERAFELLTRDIYELMKMGEISTRDGWDGVKSG 192

  Fly   197 FSR----PNSLDFNLVVAEPEKSSCC 218
            .:.    |...:     ||.|||..|
Zfish   193 LTAKVLYPAEEE-----AEREKSCNC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 114/213 (54%)
rab42aNP_998207.1 Rab39 7..213 CDD:133311 114/213 (54%)
RAB 9..172 CDD:197555 95/165 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 202 1.000 Domainoid score I2940
eggNOG 1 0.900 - - E2759_KOG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3349
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416096at2759
OrthoFinder 1 1.000 - - FOG0003983
OrthoInspector 1 1.000 - - otm25140
orthoMCL 1 0.900 - - OOG6_105997
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.