DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab26

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:203 Identity:79/203 - (38%)
Similarity:131/203 - (64%) Gaps:13/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAE---LSDPTVGVDFFARLIEMKDGTQIKLQLW 64
            |..|:...::|::|||.|||:|||..|.||::..   ||  |||:||..::: :.|||::|||:|
  Fly   206 EDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLS--TVGIDFRNKVV-VVDGTRVKLQIW 267

  Fly    65 DTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLI 129
            ||||||||||:|.:|||::..:||:||::|..::::|..|:.|.:.:.: ...|..|:|.|.|. 
  Fly   268 DTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQ-EDVVIVLIGNKADC- 330

  Fly   130 NAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIK 194
             :|..|:|..|:.::..::|.:.|:||||::|.|||.:|..|.:::.:|   |....:||...:.
  Fly   331 -SGSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR---GYEHGDDGKFNVH 391

  Fly   195 SGFSRPNS 202
            . |.|.|:
  Fly   392 D-FVRDNT 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 77/198 (39%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 77/195 (39%)
RAB 214..378 CDD:197555 70/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.