DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab3

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:167 Identity:66/167 - (39%)
Similarity:105/167 - (62%) Gaps:6/167 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQE 70
            |:|.|:|::||:|:|||:|.|..:.|..|......|||:||..:.:...| .::|||:|||||||
  Fly    18 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHD-KRVKLQIWDTAGQE 81

  Fly    71 RFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHR 135
            |:|:||.:|||.::|.:|:||::|..||..:..|:.:.:.:...:..|. |||.|.|:.:   .|
  Fly    82 RYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVI-LVGNKCDMED---QR 142

  Fly   136 EVTTEEAQKFAKQHGLHFVETSARSGANVEEAF-RMV 171
            .::.|..::.|.|.|:.|.||||:...||:..| |:|
  Fly   143 VISFERGRQLADQLGVEFFETSAKENVNVKAVFERLV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 65/165 (39%)
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 64/164 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.