DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab6

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster


Alignment Length:200 Identity:73/200 - (36%)
Similarity:113/200 - (56%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFR 73
            :|:|:.:|:.:|||:||:..|....|......|:|:||.::.:.::|.| ::|||||||||||||
  Fly    12 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRT-VRLQLWDTAGQERFR 75

  Fly    74 SITKSYYRNSVGVLLVYDISNHASFEHIPLWM--MEAQRHIEPHRPVFALVGCKLDLINAGGHRE 136
            |:..||.|:|...::||||:|..||.....|:  :..:|..:   .:..|||.|.||   ...|:
  Fly    76 SLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSD---VIIMLVGNKTDL---SDKRQ 134

  Fly   137 VTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVT-----------------QEVYARIRSGEY 184
            |:|||.::.||:..:.|:||||::|.||::.||.|.                 |||..:....|.
  Fly   135 VSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNET 199

  Fly   185 KAEDG 189
            |..:|
  Fly   200 KDPEG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 72/199 (36%)
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 67/166 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.