DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab10

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster


Alignment Length:222 Identity:83/222 - (37%)
Similarity:125/222 - (56%) Gaps:23/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWD 65
            |.:..::..|:|:|||||.|||:.:|..|:|..|......|:|:||..:.:|:: |.:||||:||
  Fly     1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELR-GKKIKLQIWD 64

  Fly    66 TAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRH----IEPHRPVFALVGCKL 126
            |||||||.:||.||||.::|::|||||:|..|||:|..|:.....|    :|.     .::|.|.
  Fly    65 TAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEK-----MILGNKC 124

  Fly   127 DLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWD 191
            |:.:   .|.|..|..:..|::||:.|:||||:|..|:|.||..:.:.:..: .||...||:...
  Fly   125 DMTD---KRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDK-TSGRESAENQER 185

  Fly   192 GIKSGFSRPNSLDFNLVVAEPEKSSCC 218
            .|         :|.......|..|.||
  Fly   186 VI---------IDRRNQEKAPGYSKCC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 80/213 (38%)
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 72/174 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.