DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and RAB37

DIOPT Version :10

Sequence 1:NP_572405.2 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001006639.1 Gene:RAB37 / 326624 HGNCID:30268 Length:223 Species:Homo sapiens


Alignment Length:222 Identity:83/222 - (37%)
Similarity:139/222 - (62%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSD---PTVGVDFFARLIEMKDGTQIKLQLWD 65
            |.::...:::|:||:.|||:..|..|.||.|  ||.   .|||:||..:::.: ||.::|||:||
Human    24 PSYDLTGKVMLLGDTGVGKTCFLIQFKDGAF--LSGTFIATVGIDFRNKVVTV-DGVRVKLQIWD 85

  Fly    66 TAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMME----AQRHIEPHRPVFALVGCKL 126
            |||||||||:|.:|||::..:||:|||:|.:||::|..|:.|    |||.:     |..|:|.|.
Human    86 TAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDV-----VIMLLGNKA 145

  Fly   127 DLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWD 191
            |:   ...|.:.:|:.:..|:::|:.|:||||::|.|||.||..:.:|:  :.|:| ::|::   
Human   146 DM---SSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKEL--KYRAG-HQADE--- 201

  Fly   192 GIKSGFSRPNSLDFNLVVAEPEKSSCC 218
                    |:....:.|.::.::||||
Human   202 --------PSFQIRDYVESQKKRSSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_572405.2 Rab39 8..218 CDD:133311 80/216 (37%)
RAB37NP_001006639.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Rab26 31..220 CDD:206695 80/213 (38%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 52..67 7/16 (44%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 85..102 13/16 (81%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.