DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab39

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_780771.1 Gene:Rab39 / 270160 MGIID:2442855 Length:217 Species:Mus musculus


Alignment Length:221 Identity:118/221 - (53%)
Similarity:159/221 - (71%) Gaps:8/221 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAEL----SDPTVGVDFFARLIEMKDGTQIKLQ 62
            :|.|:.||||||:|||||||||.||..||.|:|..|    .|||||||||:||:|::.|.:||||
Mouse     1 METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQ 65

  Fly    63 LWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLD 127
            ||||||||||||||:||||||||..||:||:|..||||:..|:.||:.|::|.:.||.|||.|.|
Mouse    66 LWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCD 130

  Fly   128 LINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDG 192
            |   ...|:|:.|||::.:...|:.::||||:...||||:|.::|:::|..|:.||...:|||:|
Mouse   131 L---ASQRQVSREEAERLSTDCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEG 192

  Fly   193 IKSGFSRPNSLDFNLVVAEPEKSSCC 218
            :||||. ||::..:....:|.|...|
Mouse   193 VKSGFV-PNTVHSSEEAVKPRKECFC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 115/213 (54%)
Rab39NP_780771.1 Rab39 7..217 CDD:133311 115/213 (54%)
RAB 9..176 CDD:197555 97/170 (57%)
Effector region. /evidence=ECO:0000250 41..49 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 200 1.000 Domainoid score I3034
eggNOG 1 0.900 - - E2759_KOG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3386
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416096at2759
OrthoFinder 1 1.000 - - FOG0003983
OrthoInspector 1 1.000 - - otm42739
orthoMCL 1 0.900 - - OOG6_105997
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3742
SonicParanoid 1 1.000 - - X2743
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.