DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and Rab42

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_006538910.1 Gene:Rab42 / 242681 MGIID:2441753 Length:219 Species:Mus musculus


Alignment Length:216 Identity:92/216 - (42%)
Similarity:129/216 - (59%) Gaps:21/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YQFRLILIGDSTVGKSSLLKFFTDGKFAELS---DPTVGVDFFARLIEMKDGTQIKLQLWDTAGQ 69
            ||||:.|:||:.|||:|||:.:..|......   :|||||:|::|.:::..|.::||||||||||
Mouse     8 YQFRIALLGDAGVGKTSLLRCYVAGARGAAEPDPEPTVGVEFYSRALQLPAGLRVKLQLWDTAGQ 72

  Fly    70 ERFR----SITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLIN 130
            |.||    .||:|:|||.||||||:|::|..|||||..|..|......|.:.||.|||.|.||  
Mouse    73 ECFRCGEKCITRSFYRNMVGVLLVFDVTNRESFEHIQAWHQEVVSTQGPDKVVFLLVGHKCDL-- 135

  Fly   131 AGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKS 195
              ..|.|:::||::.|...|:.|:||||:|..||:.||..||..:...::.|:.|.:..|.|::.
Mouse   136 --NTRCVSSQEAEELAASLGMGFMETSAKSNCNVDLAFDTVTSAIEQALQQGDIKLDKDWAGVRL 198

  Fly   196 GFSRPNSLDFNLVVAEPEKSS 216
            ....||          |..||
Mouse   199 LHRSPN----------PRSSS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 92/216 (43%)
Rab42XP_006538910.1 P-loop_NTPase 8..219 CDD:393306 92/216 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0091
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.