DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and RAB42

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_016855715.1 Gene:RAB42 / 115273 HGNCID:28702 Length:220 Species:Homo sapiens


Alignment Length:194 Identity:83/194 - (42%)
Similarity:123/194 - (63%) Gaps:10/194 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YQFRLILIGDSTVGKSSLLKFFTDG-----KFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTA 67
            ||||:.|:||:.|||:|||:.:..|     :.....:||||.:.:.|.::::.|.::||||||||
Human     8 YQFRVALLGDAAVGKTSLLRSYVAGAPGAPEPEPEPEPTVGAECYRRALQLRAGPRVKLQLWDTA 72

  Fly    68 GQERFR--SITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLIN 130
            |.||||  .||:|:|||.||||||:|::|..|||||..|..|......|.:.:|.|||.|.||.:
Human    73 GHERFRCGCITRSFYRNVVGVLLVFDVTNRKSFEHIQDWHQEVMATQGPDKVIFLLVGHKSDLQS 137

  Fly   131 AGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIK 194
            .   |.|:.:||::.|...|:.|||||.::..||:.||..:...:...::.|:.|.|:||.|::
Human   138 T---RCVSAQEAEELAASLGMAFVETSVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 83/194 (43%)
RAB42XP_016855715.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0091
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.