DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and rab39a

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_002934692.1 Gene:rab39a / 100494491 XenbaseID:XB-GENE-1011717 Length:206 Species:Xenopus tropicalis


Alignment Length:187 Identity:82/187 - (43%)
Similarity:122/187 - (65%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQE 70
            :::|||::|:|||.|||:|||..:|||:|.:.:..||||||..|..|.:.|.:::||.|||||||
 Frog     5 WDFQFRVLLLGDSGVGKTSLLHRYTDGQFTDTTTETVGVDFCCREEEPEPGVKVRLQFWDTAGQE 69

  Fly    71 RFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHR 135
            |:|::|:|||||:.||||::|::...||:::..|.||.....:....||.|:|.|.||..   .|
 Frog    70 RYRAVTRSYYRNAAGVLLLFDLTTRQSFDNVTEWHMEVTERTQAKPMVFMLLGAKNDLKE---KR 131

  Fly   136 EVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDG 192
            .||.||||:.|:.....::|||||:|:||..|..::.:|:....||....:.|...|
 Frog   132 MVTREEAQRLAENLSAPYLETSARTGSNVSAALSLLCRELLRAARSQAQVSTDDSSG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 82/185 (44%)
rab39aXP_002934692.1 P-loop_NTPase 7..>171 CDD:393306 77/166 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.