DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab39 and si:dkey-34d22.2

DIOPT Version :9

Sequence 1:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001186990.2 Gene:si:dkey-34d22.2 / 100005807 ZFINID:ZDB-GENE-131127-261 Length:183 Species:Danio rerio


Alignment Length:176 Identity:69/176 - (39%)
Similarity:105/176 - (59%) Gaps:5/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERF 72
            |.|::|:|||:..|||.::..:.:|.|..: |.|:|:||.|:.:||:.|..:.||:|||.|.|||
Zfish     2 YHFKIIMIGDNATGKSCMMYRYRNGCFKHM-DCTIGMDFCAKSLEMEPGVNVNLQIWDTPGHERF 65

  Fly    73 RSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREV 137
            .....:|...|.|.|||:|:.|..:|..|.......:....|:..:|.|||.|.|    ...|||
Zfish    66 WDAILAYIPRSAGCLLVFDLGNRETFNFIKFRYSAVRTKAHPYSVLFVLVGNKCD----SEEREV 126

  Fly   138 TTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGE 183
            :.||.::||.:.|..::||||::|.||.|||.::|:.:|..:.|||
Zfish   127 SQEEVEEFASEVGAPYIETSAKTGHNVTEAFELLTRHIYQGLISGE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 69/176 (39%)
si:dkey-34d22.2NP_001186990.2 RAB 4..166 CDD:197555 64/166 (39%)
Rab 4..162 CDD:206640 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.