DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and PPM1F

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_055449.1 Gene:PPM1F / 9647 HGNCID:19388 Length:454 Species:Homo sapiens


Alignment Length:281 Identity:61/281 - (21%)
Similarity:87/281 - (30%) Gaps:94/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEA 155
            :||||.|....:..:..:  :.:||..|                                     
Human   196 VFDGHGGVDAARYAAVHV--HTNAARQP------------------------------------- 221

  Fly   156 SFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGLQMH 220
                      |.| .|....|..||.:.|:...::|....       ..||.......|.|..:|
Human   222 ----------ELP-TDPEGALREAFRRTDQMFLRKAKRER-------LQSGTTGVCALIAGATLH 268

  Fly   221 VASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIR-NGRLLSQLA 284
            ||..||...:|      .||....||...|..:...|..||.|......|....| ||    .||
Human   269 VAWLGDSQVIL------VQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNG----TLA 323

  Fly   285 PLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDKFLVIASDGL 349
            ..||.||                          .:..||::...|.....|..::.:|::|.||.
Human   324 VSRAIGD--------------------------VFQKPYVSGEADAASRALTGSEDYLLLACDGF 362

  Fly   350 WDFLPPSEVVSLVGEHINSKK 370
            :|.:|..|||.||..|:..::
Human   363 FDVVPHQEVVGLVQSHLTRQQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 61/281 (22%)
PPM1FNP_055449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PP2C 155..406 CDD:278884 61/281 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.