DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and PTC3

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_009497.2 Gene:PTC3 / 852224 SGDID:S000000152 Length:468 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:72/307 - (23%)
Similarity:121/307 - (39%) Gaps:99/307 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYE 154
            ||||||.|::..:....:::     :.|.:|   |..|.|...|    |                
Yeast    59 GIFDGHGGSSVAEFCGSKMI-----SILKKQ---ESFKSGMLEQ----C---------------- 95

  Fly   155 ASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGLQ- 218
                                 |::.||..|.|:.::....:|       .||..|.::.:..|: 
Yeast    96 ---------------------LIDTFLATDVELLKDEKLKDD-------HSGCTATVILVSQLKK 132

  Fly   219 -MHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQ 282
             :..|::||...||      :...:||.::.:|....:||..||:|.....|.:.|  ||    .
Yeast   133 LLICANSGDSRTVL------STGGNSKAMSFDHKPTLLSEKSRIVAADGFVEMDRV--NG----N 185

  Fly   283 LAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELG-PNDKFLVIAS 346
            ||..||.|||.:|.:.::...:.:                 :|..||:..|.|. ..|:|:::|.
Yeast   186 LALSRAIGDFEFKSNTKLGPHEQV-----------------VTCVPDIICHNLNYDEDEFVILAC 233

  Fly   347 DGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAE 393
            ||:||.|...|.|.||...|:           :|:.||.:||.::.:
Yeast   234 DGIWDCLTSQECVDLVHYGIS-----------QGNMTLSDISSRIVD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 72/307 (23%)
PTC3NP_009497.2 PP2C 23..280 CDD:395385 72/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.